HLSS645Wk5

profileRawono1
Relationshipbetweenhumanfactorsandasafeperformanceofvesseltrafficserviceoperators_Asystematicqualitative-basedreviewinmaritimesafety.pdf

Safety Science 155 (2022) 105892

Available online 2 August 2022 0925-7535/© 2022 The Authors. Published by Elsevier Ltd. This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by- nc-nd/4.0/).

Review

Relationship between human factors and a safe performance of vessel traffic service operators: A systematic qualitative-based review in maritime safety

F. Crestelo Moreno a,b,c,*, J. Roca Gonzalez b, J. Suardíaz Muro b, J.A. García Maza c

a Spanish Maritime Search and Rescue Agency, Cartagena, Spain b Department of Electronic Technology, Technical University of Cartagena, Cartagena, Spain c Marine Science and Technology Department, University of Oviedo, Spain

A R T I C L E I N F O

Keywords: Maritime safety Maritime accidents Human element Vessel Traffic Service (VTS) Vessel Traffic Service Operator (VTSO) Fatigue

A B S T R A C T

The growth of the world merchant fleet in recent decades has caused an increase in congestion and complexity in maritime traffic, especially in coastal areas, straits and nearby channels.

This fact, which acts negatively upon maritime safety, however, has meant a decrease in the number of ac- cidents, rather, they have even been reduced by half in the last decade.

This anomaly is explained by the implementation of Vessel Traffic Services (VTS) in these conflict areas and for this reason, in this review we will study, through the analysis of different relevant studies on the subject, the relationship between the human element and maritime safety, focusing on the figure of the vessel traffic service operator (VTSO) as a link between safety and efficiency, exploring their staffing, training, functions and factors affecting them within the maritime system.

This review was conducted following the reporting guidelines for systematic reviews based on the PRISMA 2020 model (Preferred Reporting Items for Systematic Reviews and meta-Analyses).

Also, a bibliometric analysis of the extensive academic literature pertaining to maritime safety in relation to the human factor was carried out, focusing especially on VTS and the operators that act in them, with a special focus on the period from 2000 to 2020. Based on 371 articles, the bibliometric analyses yield to us the infor- mation on the publication patterns related to the year of publication and the keywords by identifying the main thematic groups, finally extracting 11 representative articles that have been investigated in detail focusing on the influence of the human factor in maritime safety in the VTS environment.

1. Introduction

Recent maritime accidents such as the collision in February 2015 in Jebel Ali, or collision in November 2018 in Norway, highlight the importance of VTSOs in maritime safety became evident by the official reports. Most maritime incidents are related to human errors, so the understanding of human factors to reduce this issue of paramount importance.

Since its appearance in the naval sector at the end of World War II (Grech et al., 2019), human factors have been the object of study so as to improve the effectiveness and efficiency of maritime transport. It must be accepted that in the maritime domain it is a term often identified with human error, but obviously it is not limited to this last concept.

For this reason, the International Maritime Organization (IMO) encourage his partners to make an in-depth analysis about “human element”, and defines this as:

“…a complex multi-dimensional issue that affects maritime safety, se- curity and marine environmental protection. It involves the entire spec- trum of human activities performed by ships crews, shore-based management, regulatory bodies, recognized organizations, shipyards, legislators, and other relevant parties, all of whom need to co-operate to address human element issues effectively” (IMO A.947(23), 2003).

In addition to the above resolution on the human element, this subject is currently attached in the general principles of IMO within the Strategic Plan for the six-year period 2018 to 2023 (IMO A.1110(30),

* Corresponding author at: Marine Science and Technology Department, University of Oviedo, Spain. E-mail addresses: [email protected], [email protected] (F. Crestelo Moreno), [email protected] (J. Roca Gonzalez), [email protected]

(J. Suardíaz Muro), [email protected] (J.A. García Maza).

Contents lists available at ScienceDirect

Safety Science

journal homepage: www.elsevier.com/locate/safety

https://doi.org/10.1016/j.ssci.2022.105892 Received 8 March 2022; Received in revised form 28 June 2022; Accepted 22 July 2022

Safety Science 155 (2022) 105892

2

2017), thus stating the importance of this factor and establishing through this resolution, that the human element must be taken into account in the reviews, development and implementation of both new and existing requirements, including skills, education and training, and human capabilities, limitations and needs.

The Growth of the global merchant fleet over the last decades has increased considerably, not only in ships numbers but in tonnage as well, affecting maritime traffic, especially in nearby coastal areas, straits, and channels, causing congestion and traffic complexity, there- fore, ports are a crucial in the maritime transport chain and, in turn, navigation in ports has become increasingly complex the last decades due to this raise in maritime transport of goods and the size of the ships that leads to a greater flow of ships in ports (Bellsolà Olba et al., 2019).

Examples of this traffic complexity and its relationship with Vessel Traffic Services Operators in terms of safety, are the aforementioned collisions within VTS area of Jebel Ali (United Arab Emirates) between Oil Tanker “Alexander I” and the container ship “Ever Smart” on February 2015 or the recent collision between Norwegian frigate “HNoMS Helge Ingstad” and the oil tanker “Sola TS” in November 2018 within Fedje VTS area, in Hordaland County (Norway), consequently, both official reports (MAIB, 2015; AIBN, 2018) remarks the lack of monitoring, loss of the situational awareness and an inadequate over- view of the VTS area by the VTS operators, therefore, this human factor was one of the triggers of the accident.

Nowadays sea transport deals with 90 % of the total merchandise that moves around the world (OECD, 2021), and although international

Fig. 1. Marine Casualties and Incidents in last decade. (Source: Annual Overview of Marine Casualties and Incidents, EMSA, 2021).

Fig. 2. Framework of Regulations related to VTS (). Source: IALA, 2022

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

3

seaborne trade in 2020 slipped to − 3,8% due to COVID’s pandemic, growth in maritime trade volumes are expected to moderate and expand at an annual rate of +2.4 % between 2022 and 2026 (UNCTAD, 2021), therefore, maritime transportation can be defined as a fundamental activity for our society. Further increasing maritime traffic and maritime accidents revealed the idea of regulation and monitoring of maritime traffic from land.

Aware of this reality, IMO, establishes various strategies to improve the safety of this activity, which seem to be giving good results, as re- flected in the statistics of sectoral accidents. Thus, according to the European Maritime Safety Agency (EMSA), the number of total losses during the 2010–2020 decade has been reduced in general by almost 50 %, with a reduction in the number of accidents in the last 5 years (2015–2020) of 39.4 % and highlighting that the number of very serious maritime accidents was only 46 in 2020, showing a 43.3 %, that means a reduction of 466 casualties in comparison with the year 2019 (Fig. 1), taking into account that these calculations were limited to ships flying the EU flag, and with an IMO number when referring to cargo ships, passenger ships and service ships.

Finally, the analysis, conducted during safety investigations, in which it was determined that, from 2014 to 2020, 89.5 % of all occur- rences were related to human action, should be highlighted.

One of the strategies that have been developed with the increase in the number of vessels engaged in maritime transport is the need to, not only regulate, but also to monitor compliance with the standards, therefore.

Within this surveillance strategy, we must look at one of the tools that have been most widely spread lately: The Vessel Traffic Service, that is, elements intended to regulate maritime traffic in areas of special risk for navigation.

IMO recognizes the ultimate value of VTS in the management of potentially high-risk geographic areas and protection of the environ- ment with his legislative efforts present since 1950 s to nowadays, with legislative milestones such as the “Recommendation on Port Advisory Systems” (IMO A.158(ES.IV), 1968), or the “Code for the Investigation of Marine Casualties and Incidents” (IMO A.849(20), 1997).

On the other hand, technological advances led to a necessary adap- tation of the regulations, highlighting the “Guidelines for Vessel Traffic Services” (IMO A.578(14), 1985), currently revoked by a new version (IMO A.857(20), 1997). In turn in December 2020, chapter V on Safety of Navigation of the International Convention for the Safety of Life at Sea (SOLAS) 1974 was revised, and came into force on 1 July 2002. It is in this Convention published by the IMO, where we find a declaration of intent on the use of these services as a tool to guarantee maritime safety: “contribute to safety of life at sea, safety and efficiency of navigation and protection of the marine environment, adjacent shore areas, work sites and offshore installations from possible adverse effects of maritime traffic”(SO- LAS - Chapter V, Rule 12, 2002).

The recently approved Resolution A.1158 (32) “Guidelines for Vessel Traffic Services” in December 2021 by the 32nd IMO Assembly, will replace the previous resolution (IMO A.857(20), 1997).

Resolution A.1158 (32) will work as a bridge between SOLAS and IALA guidance, so it is important to understand the hierarchy of all these resolutions and therefore, the following scheme is presented (Fig. 2):

In short, a Vessel Traffic Services (VTS) could be understood as a fundamental element to guarantee safety and enhance a safety culture within the Maritime Traffic System (MTS).

On the other hand, it is worth noting the lack of consistency in the use of acronyms related to maritime traffic coordination centers, with terms such as: ’VTS’, ’VTIS’, ’traffic’, ’control’, ’coastguard’, ’port control’, ’port’, ’port control’ which are used indiscriminately. Hence, emphasis should be place on the importance of IMO Resolution A.857 (20) and the newly Resolution A.1158 (32) which, as we said, will replace the aforementioned, that recommends Vessel Traffic Service (VTS) centres in an area or sector to use a name identifier, and for that reason in all cases, the abbreviation of VTS stands for “Vessel Traffic

Services” that is shore-based services catering for vessels as explained later.

The terminology officially applied in this review focused on the staff of VTS Centres is provided to us by the International Association of Marine Aids to Navigation and Lighthouse Authorities (IALA), which are a non-profit, international technical association supported by IMO and whose function it is oriented to developing common best practice standards through publication of Recommendations and Guidelines. This intergovernmental organization, IALA, established the term VTSO and is first defined as follows: “VTS Operator (VTSO) is an appropriately qualified person performing one or more tasks contributing to the services of the VTS” (IALA G1083, 2022).

This review, therefore, analyses the human element within the VTS’s environment as a complex sociotechnical system, as we will define later, studying the VTSOs and their relation with information technology as a link with the rest of the personnel involved in maritime safety (Captains, pilots, etc.), furthermore, special attention is paid to physical and mental fatigue as one of the most influential factors in the transportation sector based on contributions from different studies related to the impact of human fatigue in all kinds of transport (e.g., road traffic, maritime transport, etc.), which causes between 15 and 20 % of existing transport accidents (Åkerstedt, 2001; Marcus and Rosekind, 2016; Zhao et al., 2021). The different initiative used in the fight against fatigue and the tools employed in diagnosis are identified and discussed.

The purpose of this research is, therefore, to highlight the bilateral relationship between the human element and safety, through the oper- ators’ resilience in shift work with high responsibility and cognitive demand, all of these factors responsible to the detriment in performance and efficiency of the operators, with consequences such as impaired attention, delay in decision-making, reduced reaction time, etc., which are triggers of various maritime accidents.

Finally, it should be noted that in this review, several human factors are highlighted, such as: fatigue, workload, teamwork, resilience, per- formance, trust and communication, all which are related to maritime safety within VTSOs. These factors are analysed in the articles selected for this review; however, the data collection from these studies are mainly subjective data (tests, interviews) which seems insufficient to characterize this issue, so this author, brings up the dilemma throughout the discussion section, about the necessity to obtain not only subjective but objective data as well, understanding by objective data as those physiological data such as temperature, heart rate, encephalograms… etc., obtain by specific sensors.

Another controversy that is observed throughout the review is about the maritime experience as a counterpart to the negative factors, where the authors do not agree on this issue, although the majority support the experience benefit, so more studies are needed on the subject.

In summary, this article is structured as follows: review methods used are explained in Section 2, in turn in Section 3 is introduced the figure of the maritime traffic controller, related to maritime safety, emphasizing the importance of this position and its organization. The issue of fatigue is also pointed out as the core factor of most maritime traffic accidents. What is left of this article is framed into Section 4 de- scribes how the data was collected using both PRISMA framework and a bibliometric analysis, presenting the results obtained from them at the end of this section, then, in Section 5, the most representative compile articles are analysed and discussed. Finally, Section 6 provides final comments.

2. Methods

This review was carried out following the updated guideline for reporting systematic reviews based on the PRISMA 2020 model (Page et al., 2021) to ensure that the relevant literature is adequately covered and the data for this study were retrieved from EBSCO HOST database.

On account of the multidisciplinary nature of the study, both psy- chosociological and technical, and in order not to miss any important

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

4

article, initial raw search was carried out, which returned close to 65,000 results, so with a view to reducing results to more specific studies and make an easy to read identification of the related publications, several filters and four topics are used to identify safety-related issues affecting performance of vessel traffic service operators, these topics being:

• topic 1: “Ship” or “Vessel” or “Maritime Shipping”, and. • topic 2: “Ship traffic control”, and. • topic 3: “Maritime Safety”, and. • topic 4: “Navigation”.

All these studies were double-checked incorporating into the revision a doctorate in merchant marine and Senior Technician for Work Hazard Prevention in order to avoid bias in article selection.

The qualitative methodology is summarized in the flowchart of Fig. 3.

In addition, a quantitative bibliometric analysis by co-occurrence, was carried out on the dataset containing the identified safety-related publications that affect the performance of Vessel Traffic Services Op- erators (VTSOs), using the free software “VOSviewer” (Visualizing sci- entific landscapes), being one of the most used methods in bibliometric analysis (Li et al., 2021).

The final purpose of the methodological framework designed ad hoc for this review, aims to answer the following questions regarding the VTSOs:

(1) What are the human factors involved in VTSOs tasks? and. (2) What is the relationship between human factors and the safe

performance of VTSOs?

We address these questions in the discussion section, finding how fatigue, mental factors, teamwork and communication and trust, are safety key elements.

3. Vessel traffic services: The figure of the maritime traffic operator

This section defines maritime traffic services and introduces the figure of the VTSO, as well as its organization and staffing, outlining the relationship between maritime safety and VTSOs through the human factor, paying special attention to fatigue (see Fig. 4).

3.1. VTS structure

Vessel Traffic Services (VTS) are recognised internationally as a

Fig. 3. Review’s Methodology Flowchart.

Fig. 4. Maritime Rescue Coordinator Centre of Cartagena (Spain), (Left Side) VTS Operator on duty; (Right Side) Information Displays. (Own source).

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

5

navigational safety measure through the International Convention on the Safety of Life at Sea 74/78 (SOLAS), and on the other hand, the VTSOs are appropriately qualified people as defined above, and as a consequence, these specialised services and operators are directly related to maritime safety in their task to assist the mariner in the safe and efficient use of the waterways, originating a perfect symbiosis be- tween controllers and vessels through the VTS which are implemented by the different nations with responsibilities in their adjacent maritime zones in order to improve safety, maritime traffic efficiency and marine environment protection.1

A VTS is a Socio-technical system, this is a term coined by Tavistock Institute research program in the 1950 s, and it can be defined as:

“…increasingly common classes of large-scale system that feature a combination of technological systems (where hardware and software technology feature as significant elements within the system), human interfaces, and human-intensive organisational systems” (Jackson, 2010).

IMO has adopted guidelines on VTS (IMO A.1158(32), 2022) which should be used when planning and implementing a VTS, but these guidelines only address VTS present in coastal or harbour areas or a combination of both coastal and port/harbour areas. Furthermore, SOLAS, specifically states that “The use of VTS may only be made mandatory in sea areas within the territorial seas of a coastal State” (SOLAS - Chapter V, Rule 12, 2002).

However, the EU has more than 35,000 km of canals and rivers linking hundreds of key cities and areas of industrial concentration and in this context, several countries in the late 1990 s, started to work on information systems for inland shipping; these services would eventu- ally be known in Europe as River Information Services (RIS). To that end, RIS were implemented with the aim of a safe and efficient transport process and thus contribute to an intensive use of inland waterways.

Subsequently, RIS are the harmonized information services to sup- port traffic and transport management in inland navigation (where present, an Inland VTS is part of RIS, but a RIS does not necessarily have to include a VTS) including interfaces to other transport modes (PIANC, 2011).

IALA Guideline (IALA G1166, 2022) on VTS in Inland Waters, Chapter 4.3.2., in reference to the considerations on continental waters establish:

“The close confines of many inland waterways and the ability to maintain a comprehensive traffic image may result in a more limited ability to respond to developing situations”.

Stressing in the same chapter:

“While decision support tools may differ, they are likely to be of similar value to an inland VTS as it is to a VTS in coastal waters and port/ harbour areas and the IALA guidance of equal relevance”.

In these statements, IALA hints that although the purpose and functions may be similar, they are not the same. For this reason, in this review we focus mainly on coastal VTS and their operators, who are staffing (IALA G1045, 2022), operational procedures (IALA G1141, 2022) and training (IALA G1156, 2022) are clearly defined by IALA through its Standards, Recommendations, Guidelines and Model cour- ses, which are applicable worldwide.

In addition, IALA has a guideline, (IALA G1166, 2022), to assist authorities establish inland VTS in inland waters effectively and in a manner that reflects the international regulatory regime for VTS while RIS Guidelines should be complemented by detailed guidelines and standards for applications in specific parts of the world.

These implementation RIS peculiarities, are defined in the guidelines

and recommendations prepared by the World Association for Water- borne Transport Infrastructure (PIANC):

“The implementation of RIS based on these RIS Guidelines requires the use of RIS key technologies as standardised by the European Commission and/or the Central Commission for the Navigation of the Rhine. These standards are a pre-condition for the implementation of RIS in the CCNR and EU member States” (PIANC, 2011).

Hence, the need to harmonize internal VTS through international guidelines worldwide and these guidelines should therefore follow the IMO guidelines on VTS as closely as possible. This Recommendation should be used whenever the application of the IMO guidelines on VTS is considered inappropriate (IALA VTS MANUAL, 2021).

3.2. Organization and staffing into vessel traffic services

Recently, there has been a fast growth in vessel traffic services, which has led to a relevant increase in the number of VTS operators required world-wide. Nowadays there are over 500 VTS centres around the world (IALA VTS MANUAL, 2021) and in these centre’s the VTSO is “respon- sible for establishing and maintaining a vessel traffic image, which will facilitate interaction with the vessel traffic thus ensuring the safety of navigation” (IALA 1089, 2022).

There are not any definite criteria for being a VTSO; it depends on the maritime authority for each country; however, there are international recommendations and guidelines that describe the training and quali- fication of VTSOs as the Annexes of IMO Resolution A.857(20) ’Guide- lines for Vessel Traffic Services’ (VTS) that describe the skill and knowledge qualifications required by VTS Operators (VTSOs) and fol- lows: “…VTS Personnel are required to interact with other mariners with responsibility for safety… and that they are trained and qualified according to the current international IALA standards” also remark that “VTS personnel should be capable of providing information, traffic organisation and/or navigational assistance service in the area specified by the relevant VTS Authority…”.

On the other hand, this guideline is also addressed to Contracting Government(s) urging to.

“…ensure that the VTS Authority has sufficient staff, appropriately qualified, suitably trained and capable of performing the tasks required, taking into consideration, the type and level of services to be provided…” (IALA G1045, 2022).

In accordance with the IALA guideline cited above, the VTS Au- thority has the right to define who can be a VTSO taking into account the type and level of services to be provided, in addition to other factors such as periods of service, operational procedures, emergencies, work- load, etc.; however, there is no obligation that all VTSOs must have nautical experience or even must have a Master Mariner license, although the IMO recommends considering training and qualifications according to current IALA international standards and VTSO roles.

These roles for personnel in each VTS may vary, and generally consist of four kinds: VTS operator, VTS supervisor, VTS manager and On-the-job training (OJT) instructor (IALA G1156, 2022).

In summary, to keep VTS operations safe it is essential to have qualified VTS personnel and these qualifications will be determined through the balance between the factors mentioned above, which must be kept under periodical review.

Regarding the balance, it is necessary to mention the “risk compen- sation hypothesis”, which theorizes that when an activity is modified to be considered safer, people take more risks and the number of accidents remains constant, in other words, making situations seem more dangerous can make it safer, this phenomenon is what in the safety literature is called risk homeostasis.

The risk homeostasis theory also introduces the concept of perceived risk, in which each individual has their own acceptable target level of perceived risk and balance is achieved through constant adjustment to

1 IMO defines that a ‘Competent Authority’ should be responsible for the safety and efficiency of vessel traffic (RESOLUTION A.857 (20)).

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

6

this (Napier et al., 2007), therefore, homeostasis is the scientific term used to designate systems that tend to maintain a state of balance, in this case a constant sense of security. According to this hypothesis, if we make the environment seem safer, users will engage in riskier behav- iour, keeping the actual level of safety constant.

The paradox of this theory is that the greater the operator’s work- load, the lower the risk of accident because the perceived risk is greater and, conversely, the lower the workload, the lower the perceived risk, since the operator’s cognitive load it is lower, resulting into a feeling of less risk. This is a clear example of negative feedback or circular (not linear) causality that links changes in perceived risk to changes in behaviour (Fig. 5):

“a change in behaviour produces a change in the accident rate and a change in the accident rate brings about a change in behaviour” (Gerald J.S. Wilde, 2013).

In the previous figure it is observed that the link between the objective risk and the accident rate is the only element of linear cau- sality, so the accident rate can only be influenced by factors that affect the level of objective risk.

On the other hand, safety innovations are often used as a tool to lower the level of perceived risk. However, the individual may not have the ability to stop that risk after the introduction of a safety innovation and consequently, the operator is giving control to an interface that is not in a position to make decisions, since the sensors of a machine are not only limited but also measure different things from those measured by the senses of the human being. Therefore, as we have previously commented, it is a mere decision support tool.

Special attention should be paid to the workload factor, both due to its negative impact on the performance and motivation of the VTS personnel (Sulastri, 2020; IALA G1045, 2022), and because it is closely linked to one of the main tasks performed by VTSOs compile a traffic image that allows the operator to assess situations and make decisions accordingly.

Thus, in order to make these decisions, data should be collected, and in this respect, IALA recommend the use of decision support tools (DST) in VTS centres to enhance situational awareness (IALA G1045, 2022). Some of these support tools are technological improvements as Auto- matic Identification System (AIS) or Electronic Chart Displays (ECDIS) (S. J. Chang, 2004; Lützhöft et al., 2011) being an example of integrated devices intended to assist VTSOs and somehow increase safety; however, they have generally been implemented to raise overall productivity,

counteracting their initial safety effect. In the same way, monitoring systems like Long Range Identification

and Tracking System (LRIT) and SafeSeaNet (SSN) whose information is used by various users such as Maritime Rescue Coordination Centres (MRCC) or Port Authorities through Vessel Traffic Services (VTS), can be considered, which is the case that concerns this review, as decision- making support tools.

Therefore, SSN is defined as a network for maritime data exchange, linking together maritime authorities from across Europe exchanging information related to maritime safety, port and maritime security, marine environment protection and efficiency of maritime traffic and maritime transport (Directive 2002/59/EC, 2002; Directive 2009/17/ EC, 2009).

In turn, on May 19, 2006, four years after the established of the SSN system, LRIT system was set up under the auspices of IMO (MSC.202 (81), 2006; MSC.211(81), 2006), for reasons related to national security, making it mandatory for all passenger ships, high speed craft, mobile offshore drilling units and cargo ships of over 300 gross tonnes, and it has been in force since July 2009.

The main purpose of the LRIT ship position reports is, therefore, to enable a Contracting Government to obtain ship identity and location information in time to evaluate the security risk.

Both SSN and LRIT systems are managed and maintained by EMSA. However, unlike the other decision support tools we have talked

about, such as ECDIS, or RADAR, inputs are automatic, even radio communications may or may not be voluntary, while data fetch through the SSN or LRIT systems are always voluntary, the users (Flag States, Port States, Coastal States and Search and Rescue Authorities) must use their authorizations to access the system and obtain the information, so the VTSOs’ mental workload with these systems is relative, since they are on demand.

Despite the aid provided by these tools to counteract workload, IALA makes special consideration about the rotation of watchkeeping VTSOs and the need for breaks (IALA G1045, 2022), emphasizing that it’s depending on the intensity of work and the overall working environ- ment, and pointing out that due to the unique circumstances in each VTS Centre, it is not appropriate, nor possible, to specify the length or number of breaks necessary to avoid fatigue.

For all of the above, and according to various authors, staffing has been considered the first level of defence in fatigue-risk management (Lerman et al., 2012; Yoo and Kim, 2021) so in order to assessing appropriate staffing levels for a VTS Centre, IALA authorities develop a

Fig. 5. Homeostatic model relating “circular causality” (source: Gerald J.S. Wilde, 2013).

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

7

staffing calculation (Fig. 6) through a theoretical outcome based on local and cultural issues, predictable traffic levels, etc…(IALA G1045, 2022).

This calculation guide (IALA G1045 ANNEX A, 2018) is applicable to the VTSO and VTS Supervisor staffing levels taking into account the following considerations:

– Individual (contracted) hours per working week (’d’) are the terms of employment for an individual VTSO or Supervisor; typically, be- tween 35 and 45 hrs. per week.

– Normal hours per shift (’e’) is typically 6 – 12 h. – Hours leave per year (’f’) should be based on the number of days’

leave granted multiplied only by the shift hours per day (not the full 24 h).

– Hours sickness per year (’g’) is an estimate based on historical re- cords and averages across the VTS department.

– Hours training per year (’h’) should include the training hours scheduled for the year.

– Finally, the term (’i’) Individual minutes lost per shift for meals, handovers and breaks etc. should be based only on the individual and is necessary to generate the increase in staff required to enable staff rotation.

3.3. The VTS operator

In this section we have seen the short definition of VTS Operator (VTSO); however, it is incomplete and recently updated to the reality of

this profession closely linked to safety. According to IALA (IALA G1156, 2022), “VTS personnel are individuals that are appropriately trained and qualified in VTS operations in accordance with the relevant model course associated with their functions. They actively contribute to the safe and efficient movement of vessel traffic in conjunction with the bridge team and allied services”.

To carry out these tasks, VTSOs must rely on three key principles (IALA G1131, 2022):

– Overview of Traffic and Maintaining a Traffic Image. – Interacting with the traffic. – Responding to traffic situations in progress.

These operators are therefore responsible for establishing and maintaining a vessel traffic image and must interact with vessel traffic to improve the safety and efficiency of navigation within the VTS area responding to developing situations after a meticulous analysis of the information available.

Consequently, such specialized staff, are recommended by IALA, to possess a minimum training requirements (IALA Model Course V-103/1, 2009), such as:

– Prior skills and knowledge within VTS. – Maritime experience and education. – Personal suitability characteristics and. – Medical fitness requirements.

Fig. 6. VTS Staffing - Calculation guide (Source: IALA G1045-Ed1.1-Annex A, 2018).

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

8

VTS personnel should only be considered competent when appro- priately trained and qualified for their VTS duties (IALA G1156, 2022) through:

– Satisfactorily completing generic VTS training approved by the competent authority.

– Satisfactorily completing on-the-job training at the VTS where the person is employed.

– Undergoing performance assessment and revalidation training to ensure competence is maintained and.

– Being in possession of appropriate certification.

Also, personal aptitude, attributes and overall suitability re- quirements emphasizing previous maritime experience should be considered.

The Annexes of IMO Resolution A.857(20) ’Guidelines for Vessel Traffic Services’ (VTS) describe the skill and knowledge qualifications required by VTSOs to provide the required services to improve the safety, being Authorities the ones to determine what competencies a VTSO must have.

3.4. VTSO’s human factors: The fatigue paradigm

Human factors play a fundamental role in process safety manage- ment within a system, being designated as a system which includes the following elements: people, tasks, equipment and interfaces, environ- ment, organizations in which they work and location in the world (Randle, 2021).

Related to maritime system, the human factor has always been a constant concern within the sector as can be deduced from early IMO regulations on fatigue factors in manning and safety (IMO A.772(18), 1993), which provides an overview of fatigue and identifies factors in ship operations that may contribute to it.

Fatigue is caused by a range of factors as lack of sleep due to poor quality of sleep and rest (Phillips et al., 2017; Engle-Friedman et al., 2018), also by work/sleep at inappropriate times of the body clock, which implies alterations of the circadian rhythm (MacLean et al., 2003; Moore-Ede et al., 2004), or staying awake for long periods without forgetting stress and excessive workload resulting in prolonged mental and/or physical exertion (Borbély, 1982; Desmond and Hancock, 2000; Dorrian et al., 2011).

Taking this into account, IMO consider fatigue as a hazard that af- fects safety, health and well-being and it presents a considerable risk to safety of life, property, health, security and protection of the marine environment (MSC.1/Circ.1598, 2019).

At the same time, the increase in maritime accidents between the end of the 20th century and the beginning of the 21st (Ćorović and Djurovic, 2013) involving human factors (Luo and Shin, 2019) and with fatigue as a main trigger, led IMO’s Maritime Safety Committee on May 1999 to consider human fatigue as a cornerstone in safety issues and conse- quently develop a practical guidance to deal with it in the maritime environment.

These first regulatory efforts by the IMO (MSC/Circ.1014, 2001) and subsequent updates (MSC.1/Circ.1598, 2019), provide a regulatory framework on fatigue from which the definition is derived:

“A state of physical and/or mental impairment resulting from factors such as inadequate sleep, extended wakefulness, work/rest requirements out of sync with circadian rhythms and physical, mental or emotional exertion that can impair alertness and the ability to safely operate a ship or perform safety-related duties” (MSC.1/Circ.1598, 2019).

Therefore, fatigue is a key factor in maritime safety related to VTS environment (Li et al., 2020b), that as in many other jobs in the trans- port sector and elsewhere include a blend of physical and mental tasks that together result in a merged general feeling of fatigue, and mental tiredness.

Human fatigue is often pointed out as the core factor of most traffic accidents (Bye and Aalberg, 2018).

4. Data collection procedure and results

This section, touches upon the process of collected data and the ways to obtain the results for the research.

4.1. Data collection procedure

After a careful abstract reading of the dataset obtained, and after applying the methodology discussed above, to ensure the relevance of the articles for the intended coverage of the review, as a result, we collected 493 papers from our keyword search, leaving 371 papers to be screened due to duplicate records mainly.

Additional 335 papers were removed after the title and abstract screening, so 36 were retrieved but 10 were removed because there is no available data, or were conference proceedings.

Consequently, a remaining of 26 papers were assessed for eligibility which resulted from criteria and a full-text screening, was completed on these papers. That produced the exclusion of an additional 17 articles because they were out of scope. A total of 11 papers were eligible for data extraction as representative for this review. Of these 11 papers, 3 articles focused on fatigue, 2 on mental workload, 2 on impact of new

Fig. 7. Graphic Summary of the Data Collection Procedure. (Left side) Identification of studies via databases and registers / (right side) Number of Studies included in review.

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

9

technologies and resilience, 2 on performance on sociotechnical system, 1 on teamwork and 1 on communications and trust (Fig. 7).

A detailed identification flowchart following PRISMA guidelines is shown in Fig. 8.

4.2. Bibliometric analysis and qualitative systematic review

In this work, in addition to diagrams and flowcharts, the free soft- ware “VOSviewer” is applied, which is used to carry out bibliometric analyses by constructing and visualizing bibliometric networks. In this way, co-occurrence analysis was performed, where the publication keywords are shown as items, where the size of each one correlates to the number of occurrences.

As shown in Fig. 9, 45 items are spotted as critical publication key- words addressing human factors related to maritime safety. All the keywords in the figure stand for points with more than five happenings in the chosen 371 publications. The most recurrent items are ’Maritime Shipping’ (36 occurrences) and ‘Safety’ (33 occurrences), followed by ‘ships’ (27 occurrences), ‘risk assessment’ (27 occurrences),’navigation’, (19 occurrences), ‘harbors’ (17), ’e-navigation’ (12 occurrences) or ‘Ship Traffic Control’ (10 occurrences), ’Human Factors’ and ’VTS’ (8 occurrences).

The connections between the keywords in the publications are shown by the links between the items whose terms are commonly found together represented by thicker lines.

Consequently, extra clustering of such terms allows expert inter- pretation of forthcoming narrative patterns in the research area.

Hence, in this study the items were gathered in seven clusters, so as to represent terms which are strongly linked to one another than other terms in other clusters resulting as follows:

• cluster 1 (RED): “AIS”, “collision avoidance”, “collisions at sea”, “computer simulation”, “collisions at sea”, “e-Navigation”, “human factors”, “safety”, “ship traffic control”, and “VTS”;

• cluster 2 (YELLOW): “focus group”, “human error”, “international law”, “marine accidents”, “maritime safety” and “rescue work”;

• cluster 3 (BLUE): “accidents”, “automatic identification”, “container ships”, “forecasting”, “risk assessment”, “ships” and “system identification”;

• cluster 4 (GREEN): “case studies”, “cognition” or “communication”, “decision making”, “emergency management”, “harbors”, “mari- time” and “waterway”;

• cluster 5 (PURPLE): “big data”, “information storage & retrieval systems”, “marine vehicles”, “navigation”, “navigation in shipping” and “situational awareness”;

• cluster 6 (LIGHT BLUE): “electronic navigation”, “probability the- ory”, “traffic engineering”, “traffic flow” and “traffic safety”;

• cluster 7 (ORANGE): “maritime shipping”, “simulation”, “simulation methods and models” and “transportation”.

As a result, the high number of clusters obtained from this analysis, is an example of the multidisciplinary nature of the subject studied, human factor (VTSO) related to maritime safety within VTS area.

Although all the clusters obtained are related to safety, the publi- cations bounded by the red cluster are the most representative of a plausible narrative centred on traffic control and human factor mean- while the yellow cluster can be understood to stand for a narrative pattern addressing accidents and human error.

On the other hand, there are some conflicting terms in the network and its clusters, for example, AIS (red group) and automatic identifica- tion (blue group), indicating that the identified narrative patterns are mainly intended as a basis for discussion.

In contrast to the figure previously cited related to the co-occurrence

Fig. 8. PRISMA 2020 flow diagram for new systematic reviews which included searches of databases, registers and other sources used to identified this re- view reports.

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

10

of keywords, the following image (Fig. 10) shows the transient trend of the focus items in the narrative patterns about safety in the maritime sector, related to the human factor. It is remarkable how at the begin- ning of 2012, the publications were more focused on the analyses related to risk assessment, and how this trend change from 2016 until nowa- days, focusing on issues more related to safety, ships, ports and navi- gation in all its aspects (e-navigation, maritime shipping, etc…).

Recently, researchers have paid more attention to other issues intrinsically related to safety, such as VTS systems, human error, big data, AIS, and situational awareness, among other topics.

5. Discussion and analysis

There are several studies aimed at the implementation of the tech- nological aspect of VTS, mostly related to various aspects of monitoring and vessel tracking (S. A. Midwood et al., 1998; Harre, 2000; S. J. Chang, 2004; Ming-Cheng Tsou et al., 2010; Xie et al., 2011); however, few studies are aimed to report the working conditions and cognitive de- mands of the VTSO, that’s why this review aims to classify the main initiatives and methods of the last decade used by researchers to identify human factors related to safety in the framework of VTS domain.

VTS is frequently compared to Air Traffic Control (ATC) however, although the systems share common goals, there are huge differences between them; ATC is rather stiff in its design with clear procedures to cope with several situations. VTS, on the contrary, is a very flexible system that leaves the details of execution to the actors in a situation (Praetorius et al., 2012).

The VTS system is considered a complex sociotechnical system (Praetorius et al., 2015; Relling et al., 2019) and requires highly specialized personnel prepared to deal with situations that often go beyond protocols and procedures.

The studies’ structuration was designed applying the principle of the “Five Ws” first established by Aristotle in his work “Nicomachean Ethics” (Aristotle, 2000) based in Hermagoras of Temnos’s method of dividing a topic in seven elements of circumstance or Septem Circum- stantiae. Some authorities add a sixth question, “how”, to this list, but “how to” information generally fits under what, where, or when, depending on the nature of the information (Table 1).

Studies in recent years related to VTSOs have been tabulated and synthesized in six key epigraphs (Table 2), following the structure mentioned above, gathering essential information about the different investigations about the influence of human factors on safety within the VTSOs’ environment.

5.1. Studies (Who, When)

Studies by prolific authors with ascendancy on maritime safety and human factors have been chosen. The authors are therefore related to the maritime environment, either directly having served as merchant marine officers or with a more academic profile, but always related to the maritime domain.

Either way, recent publications were selected for this review since the technological advance in this area affects the performance of the operator positively or negatively, as we will see later.

Fig. 9. Network visualization of co-occurrence analysis by keyword in the 371 publications related to safety affecting performance of VTSO from 2000 to 2020, created by VOSviewer.

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

11

The collected studies have been carried out in the workplace during VTSOs’ shifts that is to say in real work situations.

5.2. Safety key point studied (Why)

In this section, leitmotiv of collected studies is pointed out, all of them based on human factor and inherently related to safety. Most of the authors opted for the analysis of both physical and mental fatigue (Kum and Furusho, 2014; Murai et al., 2015; Yen et al., 2016; Li et al., 2020a, 2020b) or for the organizational structuring of the staff in a complex sociotechnical system depending of teamwork (Praetorius et al., 2015; Mansson et al., 2017; Relling et al., 2019), only one of the studies compiled (Bruno and Lützhöft, 2010) deviates from this trend and an- alyses communications and trust as a key factor in maritime safety issue.

Therefore, objectives are widely ranged depending on the factor analysed, in the case of studies focused on operators’ fatigue as a safety factor, range from fatigue prediction by detecting causal factors to analysing the relationship of fatigue onset with shift work.

On the other hand, the other collected studies for this review that are addressed to the performance and organization of the human factor in a complex VTS system, and along the same lines based on maritime safety, the goal is a greater understanding of the operators’ tasks, how they affect communications and in general how activities are carried out in a VTS environment.

However, all these investigations have a common target: to study how the human factor (VTSOs) affects safety of the maritime environ- ment within the VTS area.

Summing up, methodology used to evaluate the influence of human factor in sociotechnical systems were based on task analysis (Praetorius et al., 2015; Relling et al., 2019) or in a categorization and qualitative analysis of data collected (Bruno and Lützhöft, 2010; Mansson et al., 2017) while studies that worked with objective measurements (Kum and Furusho, 2014; Murai et al., 2015) used computerized software analyses methods oriented to the treatment of physiological data obtained through sensors such as heart rate monitor, thermal imaging tempera- ture detector, eye tracking sensor… etc.

5.3. Sample (Where)

The studies were conducted at VTS centres where volunteers perform their duties. Operators working on these centres have different tasks depending on geographic situation and providing services (information, traffic organization, navigational assistance), they can also be respon- sible for issuing berth clearances, and clearances to leave anchorage, and they can besides work closely together with other services, such as pilot

Fig. 10. Temporal evolution of keyword co-occurrence analysis in the 371publications related to safety affecting performance of VTSO from 2000 to 2020, created by VOSviewer.

Table 1 Five Ws principle (and 1H) structure.

Five Ws Who are the authors of the studies? When was this research published? Why were these factors chosen? Where has this research been developed? What did this research show? (conclusion) How was the data acquisition performed?

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

12

service, lock service and tug service. On the other hand, these studies are concerned about the level of

confidence of the sample as they do not express the population size of the studied sector. There isn’t information about VTSOs in the world, however, VTS are well established all over the globe, according to IALA (IALA VTS MANUAL, 2021), it is assumed that there are 500 VTS areas that have been monitored with 3 operators per console (on average) and operated in 3 shifts which means 9 operators a day, plus 9 operators’ backup for replacement. Examining (Kum and Furusho, 2014) calcula- tions it might be assumed that there are 10,000 VTSOs all over the World and supposing a confidence level of 1 % with a tolerance of ± 10 %, the sample size should be 164 operators, with these figures only one study meets the minimum, so the interpretation could not be generalized for all VTSOs in the World.

Even more, volunteers in these studies vary widely both in age, gender and VTSOs’ experience (Table 3), therefore it is necessary to analyse these factors individually in relation to the key factor studied, having more effect, for example, age factor in the fatigue onset, than in mental workload or teamwork.

It should be noted that in the gender aspect there is still a majority of male volunteers, it is due to the fact that nautical profession continues to have a long male tradition and nowadays there is still a gender imbal- ance in maritime professions.

5.4. Chosen factors (Why)

Human factors examine the relationship between human beings and the systems with which they interact by focusing on improving effi- ciency, creativity, productivity and job satisfaction, with the goal of minimizing errors. (Kohn et al., 2000).

Human factors are therefore a key factor in maritime safety and specifically those related to the VTS environment, which is why the collected publications focus on investigating the influence of the human

factor on maritime safety, having the VTSOs as a cornerstone. With this objective in mind, safety, each author has focused on

investigating a specific influencing factor that affects operators thus presenting their different conclusions.

Fatigue, teamwork, workload, performance-related resilience, trust, and communication are some of the factors studied and analysed below.

5.4.1. Fatigue studies VTSOs undergo multidimensional fatigue, and physical fatigue

seems to be more serious than cognitive fatigue in VTS (Li et al., 2020a), from this claim, the author analyses the prediction and occurrence of fatigue, emphasizing that there is no clear and widely recognized defi- nition of human fatigue, thus developing a new definition of fatigue based on aspects both physical and psychological: “Task-related human fatigue is a suboptimal physical, emotional, motivational, cognitive condition caused by a prolonged period of exposure to task-related stimuli”. Following this trend, authors also explore causal of fatigue and identify twelve key causal factors and ten symptoms (five physical, two emotional, one motivational and two cognitive symptoms) of human fatigue in VTS, determining that the ’Language barrier’, workload, monitoring prob- lems such as information overlap, unnecessary ship alarms, lack of standardization of markers, etc., are elements that contribute to fatigue onset and can be corrected. The physical fatigue issue is highlighted due to the high probability of suffering this kind of distress, with effects such as tired eyes and stiff neck, so training courses to cope with this fatigue are recommended. These same authors develop a novel fatigue predic- tion algorithm that considers contextual factors (Li et al., 2020b) and invalidates traditional biomathematical models of fatigue because they are not suitable for VTS due to dynamic working conditions (e.g., traffic density, weather conditions, etc…). However, sleep disorder in opera- tors were not considered in this study so this limitation affects the us- ability of this model in practice.

Delving into key causal factors (Fig. 11), some authors (Yen et al.,

Table 2 Summary of articles related to the influence of human factors on safety within the VTSOs’ environment in the last decade.

Year Author Safety Point Studied Data Collection Analysis Method Sample

2020 Aylward et al

Impact of new technologies (Sea Traffic Management (STM)) in VTSOs performance

Observational methods and questionnaires (online survey software Qualtrics) using the European Maritime Simulator Network (EMSN)

Analysis by experienced VTS instructor throughout the simulations carried out.

16 VTSOs from 7 EU countries

2020 Li et al. (1) Fatigue Interviews & Questionnaires Hierarchy Task Analysis (based on SHELL model)

68 Singapore VTSOs

2020 Li et al. (2) Fatigue Prediction Questionnaire survey Algorithm (XGBoost) 132 Singapore VTSOs 2019 Relling et al. VTSOs performance in a

complex Sociotechnical System (VTS)

Interviews & Observations Applied Cognitive Task Analysis (ACTA) and a Critical Decision Method (CDM)

7 Kvitsøy (Norway) VTSOs

2017 Mansson et al.

Teamwork in the Maritime Traffic System (MTS)

Interviews and interactive polling tool Qualitative Analysis 54 subjects (18 Australian’s VTSOs & 31 maritime professionals from different countries)

2017 de Vries Navigational assistance performed by pilots and VTSOs in a Sociotechnical System

Interviews & Observations Functional Resonance Analysis Method (FRAM)

7 VTSOs & 9 Pilots, from 5 nationalities

2016 Yen et al. Mental and Physical Fatigue Questionnaires Mathematical model 98 Taiwan VTSOs 2015 Praetorius

et al. VTSOs resilience in a complex Sociotechnical System (VTS)

Interviews & Observations/Workshops Functional Resonance Analysis Method (FRAM)

8 informants who worked as VTSO in VTS studied from North Europe

2015 Murai et al. Mental Workload Thermography (Nasal Temperature) Timing analysis of temperatures variation in a defined nasal point related to the port coordinator’s tasks

7 Hataka (Japan) Port Coordinator

2014 Kum and Furusho

Mental workload factors Measure of Heart rates Eye movements & Nasa-TLX Questionnaires

Heart rates analysed by Polar software (model S 810i) Eye mark recorder data analysed by Frame-by-Frame method Questionnaires analysed by software SPSS 13.0

8 Istanbul VTSOs (heart rate) 3 Istanbul VTSOs (eye movements) 172 Japan & Turkish VTSOs (questionnaires)

2010 Bruno and Lützhöft

Communication and trust Literature studies, field research, observations, focus group and interviews

Qualitative analysis VTSOs from 3 centres: Sweden, Netherland, and Swedish/Danish

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

13

2016) went further and investigated how shift work affected the fatigue onset using for this purpose fatigue questionnaires and mathematical models.

It was concluded that shift work affects sleeping quality, one of the most important factors along with workload, that affects fatigue levels and therefore would be detrimental to the outcome of the controllers work and even cause health consequences due to lack of rest and circadian disorders.

5.4.2. Teamwork studies Teamwork in the maritime traffic system has been identified as an

area of concern (Mansson et al., 2017), being the VTSOs, one of the most important pieces of the system by serving as a link between pilots and vessels and monitoring designated waters, ensuring safety into them.

The research target was understanding how everyday activities are performed through qualitative research interviews in which eighteen Australian VTSOs were involved.

A lack of common ground was found in terms of the role of different team members with variable level of involvement by VTSOs, being un- clear about what they had to do or should do, further prioritizing administrative tasks or commercial interests over monitoring and interacting with ship traffic (primary task for VTS operators according to international recommendations and guidelines). Concluding that to facilitate coordination and therefore improve security, a further imple- mentation of VTS is suggested.

5.4.3. Workload studies Nowadays, mental workload is an important factor in human error,

especially so, when human resources (safe manning) on board have been reduced, it is for that reason that many authors research VTSOs work- load as a key factor in maritime safety (Kum and Furusho, 2014; Murai et al., 2015; Yen et al., 2016).

Diverse methods have been used by these authors to characterize operators’ workload, (Kum and Furusho, 2014) by data analysis ob- tained from sensors and questionnaires combination, they found that VTSOs have the greatest mental workload at the beginning of the watch meanwhile they become aware of the traffic conditions in their VTS sector and decrease during the middle of the watch but in contrast performance starts to decline due to tiredness. Furthermore (Yen et al., 2016) they identify workload as an important fatigue factor.

It is also highlighted in this study that the information processed by the operator is delayed due to excessive mental work (the information

Table 3 Age, gender, and VTSOs’ experience extracted from the analysed studies.

Study Sample Gender VTSOs Experience Average

Age Average

Aylward et al, 2020

16 VTSOs (13 men and 3 women). Eight VTSOs were from Sweden, 6 from the UK, and 2 from Norway

ranged from < 1 year to 11–20 years

between 20 and 69 years

Li et al., 2020a

68 Singapore VTSOs (47 males; 9 females) Rest of volunteers no response (response rate 80 %)

11 years 41 years

Li et al., 2020b

132 Singapore VTSOs (119 males; 13 females)

11 years N/A

Relling et al., 2019

7 Kvitsøy (Norway) VTSOs (all males)

5.3 years 42.4 years

Mansson et al., 2017

54 subjects (18 Australian’s VTSOs gender Not Available)

N/A N/A

de Vries, 2017

7 VTSOs & 9 Pilots (gender Not Available)

Over 20 years N/A

Yen et al., 2016

98 Taiwan VTSOs (96 males; 2 females)

≈ 15 years 50 years

Praetorius et al., 2015

8 North Europe VTSO (gender Not Available)

6 to 26 years N/A

Murai et al, 2015.

7 Hataka (Japan) Port Coordinator (5 males; 2 females)

5.39 years N/A

Kum and Furusho, 2014

8 Istanbul VTSOs (heart rate) (all males) 3 Istanbul VTSOs (eye movements) (all males) 112 Japan (JP) & 60 Turkish (TR) VTSOs (questionnaires) (Turkish are all males but no gender info from Japan)

2.5 years 2 years 5.04 (JP); 2,75 (TR) years

41.1 years 37 years 49.1 (JP); 39.1 (TR) years

Bruno and Lützhöft, 2010

VTSOs from 3 centres: Sweden, Netherland, and Swedish/Danish (gender Not Available)

N/A N/A

Fig. 11. VTSOs’ fatigue causal network (Li et al., 2018).

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

14

exceeds their capacity) on the other hand when the operators have little mental workload, they lose their attention and tend to make mistakes easily.

The study ends by concluding that the mental workload depends entirely on the individual elements and is related to the nature of the task, however, the experience (experience at sea and experience as operator) had a partial effect (beneficial) on mental workload.

On the other hand, (Murai et al., 2015) they used thermography to characterize the workload because the facial temperature is easy to measure with a thermal camera and is able to obtain the data without stress for the subjects since there are no sensors that affect motion. The only limitation is to frame the subject.

This study focused on the temperatures of the facial area, specifically in the nasal tip where the effect of temperatures related to workload is more prominent. The analysis of these nasal temperatures resulted in fluctuations in events with a high concentration of VHF communica- tions, while in periods of relaxation without communications these temperatures increased dramatically, pointing out low workload.

However, previous studies highlight and confirm the importance of the VTSOs’ experience; it was shown that in a highly trained veteran coordinator, the nasal temperature remained stable even with periods of high communication, so the mental workload was suppressed by experience.

The bottom line from these results, the nasal temperature decreased when the port coordinator needs the decision-making for supplying useful information to vessels and on the other hand increased when the subject is in relax time or workload were counterbalanced by experience.

5.4.4. Performance-related resilience studies A sociotechnical system in the broad sense, it is refer to how a

development of technology involves decisions upon how to distribute competences and functions between humans and technology (Herrmann et al., 2018). At present, the socio-technical theory is accepted as a joint optimisation between social and technical factors (Mumford, 2006; Walker et al., 2008).

On the other hand, FRAM is an analysis tool that reflects resilience engineering close related to safety and provides a method to describe a sociotechnical system as maritime domain (Perrow, 2011).

In this context, VTS are recognized as a sociotechnical systems (Praetorius et al., 2015; de Vries, 2017; Relling et al., 2019) in which VTSOs have to face every day complex interactions caused by area characteristics, organization and services offer, in order to provide an increased ability to anticipate upcoming events. However, complex systems are less flexible and a disruption in one or two functions can spread to a system breakdown that can be counteracted by knowledge and experience, variations in nautical and VTS-experience create vari- ations in the VTSOs (Relling et al., 2019).

Once again experience is pointed out as an important factor to countermeasure negative effects in everyday activities performance.

Finally, both authors propose recommendations to improve the performance of operators’ tasks through the implementation of stan- dards that reduce the variety (Relling et al., 2019) and by adoption of a new concept of resilience markers that identify the needs and training requirements based on the models of everyday operations (Praetorius et al., 2015).

Fig. 12. Cyclic control model adapted to VTSOs’ everyday operations related to maritime safety.

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

15

5.4.5. Communication and trust studies New technologies transform the way people interact and can easily

be applied to new forms of interaction in general. (Bruno and Lützhöft, 2010) they found that communications are closely related to trust, and state that adapting these means of communication to the context can be used as tool to trust creation based on rather small communicative de- tails, such as tone of voice, clarity of communication or the speed of a read back.

Communication and information exchange have been identified by several studies as a key factors for safe and effective traffic management and navigation assistance (Chang, 2004; Costa et al., 2018; Aylward et al., 2020). Therefore, working in a VTS the main form of direct communication between vessels and shore when underway is VHF radio, and in this way the interviewed VTSOs states sentences about commu- nications like “It’s 90 % of my work”, “As a VTS operator, communication is everything, it’s all about the communication…” (de Vries, 2017).

On the other hand, “trust” was defined as an output, or emerging property, of communication functions, some VTS operators describe their “gut feeling” on whether they trust a vessel based on the first radio contact (de Vries, 2017).

Another important result found is that the ability of the shore-based operator to see the situation from the viewpoint of the crew is crucial for the creation and maintenance of trust, somehow a nautical background can be important to reach a situational normality that is a prerequisite for the establishment of role-based trust, hence the importance of a maritime baggage with experience at sea, as opposed to results found by other authors (Kum and Furusho, 2014).

However, there is a maritime simulator study that indicates that the reliance on VHF radio may change with the implementation of addi- tional information exchange services (Aylward et al., 2020).

As a result, trust requires some kind of personal relationship between trusting individuals, but if in temporal systems, built by strangers interacting to achieve a common goal, people with deal each other more as roles than individuals, expectations should be more stable, less whimsical and more standardized hence the importance of standard phraseology used for communication at sea: Standard Marine Commu- nication Phrases (SMCP), that according to VTSOs’ interviews is an excellent tool, but due to the maritime environment is a dynamic system, SMCP needs deviations to normal languages in some situations.

In the Fig. 12 we find depicted the relationship between shore system and vessel system through the role of VTSOs (maritime safety link); therefore, their goal, is to promote traffic fluency and safety within the VTS area.

The environment data in the picture refers to meteorological con- ditions, ship’s traffic, geographical limitations (canals, rivers, straits… etc.), while equipment data, are all the inputs from sensors such as Radar, AIS, ECDIS, SNN, LRIT, VHF, CCTV, and whatever other sensor the VTS is equipped with.

The VTSOs in their duties have to deal with the complexity of daily operations and must cope with disturbances or deviations (fatigue, workload, teamwork, communications, resilience) and prepare for it, so that adequate measures can be taken to satisfy future operating demands (traffic monitoring) which means to continuously employ feedback from decision support tools (DST) so that the VTSOs can adapt its actions to the current context and possible future demands.

The operator can choose to interact with a certain vessel or the traffic as a whole, based on the anticipated change in the process or environ- ment to be controlled, namely the traffic within the VTS area. The data, both environment and equipment data, provide sensor input to the DST and the information is displayed on the interface, which is in turn the feedback for the operator.

6. Conclusions

There are several resolutions and guidelines related to the imple- mentation and requirements for the competent authorities and VTS

authorities to use to establish VTS services and the subsequent auditing and assessment of those services being the most important the Convention SOLAS Chapter V (Safety of Navigation) Regulation 12 that states that governments may establish VTS when, in their opinion, the volume of traffic or the degree of risk justifies such services apostilling that Contracting Governments planning and implementing VTS shall, wherever possible, follow the guidelines developed by the Organization, specifying that the use of VTS may only be made mandatory in sea areas within the territorial seas of a coastal State.

Nonetheless, in terms of governance related to VTS, there is lack of standardization, despite IMO Resolution A.857 (20) that provides guidelines and criteria for VTS operations that are associated with SOLAS Regulation V / 1/7/02, so for that reason, sovereign States establish varying levels of authority and service provisions to traffic control services and consequently, different models of VTS imple- mentation emerge (public or private).

Thus, the studies compiled in this review show different types of VTS as Port Radios, Coastal VTS, Information Service (INS), Traffic Organi- zation Service (TOS), Navigational Assistance Service (NAS), even a few countries (Spain, Italy, France, South Korea… etc.) have adopted more complex models of joint integration of traffic services and rescue and search operations, resulting in Maritime Rescue Coordination Centres (MRCC) or in Joint Rescue Coordination Centres (JRCC) if it encom- passes the aeronautical and maritime environment.

However, IMO, being aware of this problem, in January of 2020, through the IMO’s Sub-Committee on Navigation, Communication and Search and Rescue (MSCR 7) met and discussed the IMO-VTS guidelines in order to revise the IMO Resolution A.857 (20), sanctioned this revi- sion in the 102nd session of Maritime Safety Committee with several important changes as show in Appendix A, and which clarify the obli- gations of contracting governments about VTS and developing a regu- latory framework for their establishment.

Currently, the operational requirements depend on several concep- tual and technical requirements (IALA G1111, 2022) such as:

– Delineated of VTS area and, if appropriate, VTS sub-areas or sectors. – Type of services to be provided (INS, TOS, NAS). – Types and sizes of vessels which are required or expected to partic-

ipate in the VTS. – Navigational hazards and traffic patterns. – Human factors including health and safety issues. – Operational procedures, staffing level and operating hours of the

VTS; etc.….

Therefore, in these studies, data collection is subordinate to the functions assigned to the operators, which depend on the operational requirements mentioned above being the most important aspect both geographical location (Coastal, Port) and type of service offered (INS, NAS, TOS), (IALA S1040, 2018; IMO A.857(20), 1997) which will affect the results obtained, being difficult to extrapolate to other centres that do not have the same workload, traffic density or communications.

Most of these studies found experience (both nautical and as oper- ator) together with standardization (organization, communications, services, etc….), to be essential to counteract the negative effects of the rest of the factors studied, related to the maritime safety: fatigue, workload, teamwork, resilience, performance, trust, and communication.

Consequently, in all studies experience stands out as one of the most influential factors in each of the objectives pursued:

(Bruno and Lützhöft, 2010); Communication and Trust: “It was also generally understood that more experience with the use of a particular service led to more trust in that service…”.

(Kum and Furusho, 2014); Mental workload factors: “It was obtained that the experience (experience at sea and experience at VTS) had partial effect on the mental workload. Operators had less experience to feel higher mental workload than those who had more experience”.

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

16

Fig. 13. Key changes between Regulations A.857 and A.1158 (). Source: IALA, 2022

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

17

(Murai et al., 2015); Mental workload: “We think that this result de- pends on the experienced years. …., the mental workload was suppressed by the experience”.

(Praetorius et al., 2015); Resilience in a complex Sociotechnical System: “VTSOs are educated according to recommendations and guidelines but previous experience at sea as well as working experience as VTSO can affect the way in which this functions”.

(Relling et al., 2019); Performance in a complex Sociotechnical System “The VTS operators’ experience, such as their background and years of service, is a major source for coping with complexity. The experience af- fects how the VTS operator gathers and interprets information from the environment“.

(Li et al., 2020b) Fatigue prediction: “…it has been found that per- sonalities, experience, gender, and age would affect the experience of fatigue”.

Nevertheless there is controversy between authors regarding the experience in its double aspect, both nautical or VTSO, while (Kum and Furusho, 2014) states that there was no significant difference between the operators who have a maritime background and those who have not, (Relling et al., 2019) find that variations in nautical and VTSO experi- ence create variations in the operators’ response.

As a final thought, these studies manage to identify the causal factors of the decrease in operability, performance, effectiveness of the human factor on VTSOs and therefore, the decrease of maritime safety, but as we can see from the data obtained, they are difficult to extrapolate due to the unique conditions of each centre.

Furthermore, the characterization of the data should be re-evaluated in most of these studies, since only psychological or physiological measures are collected, where several factors such as fatigue, workload, etc., are affected by both.

As future work, a study on VTSOs and work experience counter effect over fatigue is proposed, as it is the most recognized factor in maritime accidents and therefore strictly related to maritime safety.

For this reason, the characterization of the fatigue onset, through the use of specific tests (NASA TLX, BORG, Stanford Sleepiness Scale,…etc.), by contrasting the results with the data obtained from the analysis of physiological signals through non-invasive sensors, such as thermo- graphic cameras, a sensor with which this author is familiar (Crestelo et al., 2018), appears to be a prerequisite for producing further com- parable studies in order to predict fatigue, evaluate the quality of evi- dence, and thus guide concrete actions in the field of maritime safety.

CRediT authorship contribution statement

F. Crestelo Moreno: Conceptualization, Writing – original draft, Methodology, Investigation. J. Roca Gonzalez: Supervision. J. Suar- díaz Muro: Supervision. J.A. García Maza: Supervision.

Declaration of Competing Interest

The authors declare that they have no known competing financial interests or personal relationships that could have appeared to influence the work reported in this paper.

Data availability

No data was used for the research described in the article.

Appendix A. Introduction to IMO resolution A.1158 (32) guidelines for vessel traffic services

When the 32nd session of IMO assembly approved the revised guidelines for Vessel Traffic Services on the 15th of December 2021 this was the end of a long thorough and determined revision initiated and prepared by the VTS committee.

In fact, this VTS committee in 2003, already had a revision of the

IMO Resolution A.857 on the agenda; however, for several years it would not considered an urgent and compelling need for the resolution to be revised as it also had to be brought up on the agenda of the Maritime Safety Committee of IMO.

However, a lot of work and many discussions have been done be- tween the IALA VTS committee and IMO Maritime Safety Committee during these years, and as a result of these meetings several reasons were exposed for carrying out this regulation revision, such as:

• Clarity on the role of the Competent Authority and VTS Authority, • Accommodating new developments such as the e-Navigation Mari-

time Services, • Doubts over the interpretation and application of the types of service, • Improvements in VTS communications, • Developments in VTS qualifications, training and certification, and. • The international recognition of IALA standards.

Finally, in December 2021 the Resolution A.1158 (32) was approved by IMO assembly, updating 27 IALA’s recommendations and guidelines to ensure that VTS documents align with the new resolution, with three of them being extensively revised to reflect the new IMO resolution changes:

• G1089 – Provision of a VTS - updated to reflect the change associated with removal of ‘types of service’ and clarification on the ‘purpose of VTS’.

• G1132 – VTS Voice Communications and Phraseology - new section with standardised operational phrases.

• G1141 – Operational Procedures for Delivering VTS - updated to comply with the new resolution and amendments to the above guidelines.

In summary, six important changes are introduced compared to the Resolution A.857 (Fig. 13):

• Types of VTS Services • Change of traditional boundaries • Recognition of IALA Standards • VTS Future Developments • VTS Qualifications, Training and Certification, and • Role/Responsibilities of the Competent Authority / VTS provider

References

AIBN, 2018. Report on the collision on 8 November 2018 between the frigate HNoMS Helge Ingstad and the oil tanker Sola TS outside the Sture Terminal in the Hjeltefjord in Hordaland county | nsia [WWW Document]. URL https://havarikommisjonen.no/ Marine/Published-reports/2019-08-eng (accessed 1.2.22).

Åkerstedt, T., 2001. Consensus Statement: Fatigue and accidents in transport operations. J. Sleep Res. 9, 395. https://doi.org/10.1046/j.1365-2869.2000.00228.x.

Aristotle, 2000. Aristotle: Nicomachean Ethics, Cambridge Texts in the History of Philosophy. Cambridge University Press, Cambridge. 10.1017/CBO9780511802058.

Aylward, K., Johannesson, A., Weber, R., MacKinnon, S.N., Lundh, M., 2020. An evaluation of low-level automation navigation functions upon vessel traffic services work practices. WMU J. Marit. Aff. 19, 313–335. https://doi.org/10.1007/s13437- 020-00206-y.

Bellsolà Olba, X., Daamen, W., Vellinga, T., Hoogendoorn, S., 2019. Risk Assessment Methodology for Vessel Traffic in Ports by Defining the Nautical Port Risk Index. J. Mar. Sci. Eng. 8, 10. https://doi.org/10.3390/jmse8010010.

Borbély, A.A., 1982. A two process model of sleep regulation. Hum. Neurobiol. 1, 195–204.

Bruno, K., Lützhöft, M., 2010. Virtually being there: Human aspects of shore-based ship assistance. WMU J. Marit. Aff. 9, 81–92. https://doi.org/10.1007/BF03195167.

Bye, R.J., Aalberg, A.L., 2018. Maritime navigation accidents and risk indicators: An exploratory statistical analysis using AIS data and accident reports. Reliab. Eng. Syst. Saf. 176, 174–186. https://doi.org/10.1016/j.ress.2018.03.033.

Chang, S.J., 2004. Development and analysis of AIS applications as an efficient tool for vessel traffic service, in: Oceans ’04 MTS/IEEE Techno-Ocean ’04 (IEEE Cat. No.04CH37600). In: Presented at the Oceans ’04 MTS/IEEE Techno-Ocean ’04, IEEE, Kobe, Japan, pp. 2249–2253. 10.1109/OCEANS.2004.1406499.

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

18

Ćorović, B., Djurovic, P., 2013. MARINE ACCIDENTS RESEARCHED THROUGH HUMAN FACTOR PRISMA. PROMET - TrafficTransportation 25. https://doi.org/10.7307/ptt. v25i4.1210.

Costa, N.A., Lundh, M., MacKinnon, S.N., 2018. Non-technical communication factors at the Vessel Traffic Services. Cogn. Technol. Work 20, 63–72.

Crestelo, F., Stasi, L.L.D., González, J.L.R., Muro, J.S., Gonzalez, J.R., 2018. Metodología experimental y resultados preliminares en la estimación termográfica de la fatiga operacional en operadores VTS (Vessel Traffic Service). Presented at the Congreso Anual de la Sociedad Española de Ingeniería Biomédica CASEIB 2018, pp. 145–148. Spanish.

de Vries, L., 2017. Work as Done? Understanding the Practice of Sociotechnical Work in the Maritime Domain. J. Cogn. Eng. Decis. Mak. 11, 270–295. https://doi.org/ 10.1177/1555343417707664.

Desmond, P., Hancock, P., 2000. Active and Passive Fatigue States. pp. 455–465. 10.1201/b12791-3.1.

Directive 2002/59/EC OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL establishing a Community vessel traffic monitoring and information system and repealing Council Directive 93/75/EEC, 2002.

Directive 2009/17/EC OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL amending Directive 2002/59/EC establishing a Community vessel traffic monitoring and information system, 2009.

Dorrian, J., Baulk, S., Dawson, D., 2011. Work hours, workload, sleep and fatigue in Australian Rail Industry employees. Appl. Ergon. 42, 202–9. 10.1016/j. apergo.2010.06.009.

EMSA, European Maritime Safety Agency, 2021. ANNUAL OVERVIEW OF MARINE CASUALTIES AND INCIDENTS 2021. URL http://emsa.europa.eu/newsroom/latest- news/item/4266-annual-overview-of-marine-casualties-and-incidents-2020.html.

Engle-Friedman, M., Mathew, G.M., Martinova, A., Armstrong, F., Konstantinov, V., 2018. The role of sleep deprivation and fatigue in the perception of task difficulty and use of heuristics. Sleep Sci. Sao Paulo Braz. 11, 74–84. https://doi.org/10.5935/ 1984-0063.20180016.

Gerald J.S. Wilde, C., 2013. Homeostasis drives behavioural adaptation, in: Behavioural Adaptation and Road Safety: Theory, Evidence and Action. Taylor & Francis Group, pp. 61–86.

Grech, M., Horberry, T., Koester, T., 2019. Human Factors in the Maritime Domain. 10.1201/9780429355417.

Harre, I., 2000. AIS Adding New Quality to VTS Systems. J. Navig. 53, 527–539. https:// doi.org/10.1017/S0373463300001004.

Herrmann, T., Ackerman, M.S., Goggins, S.P., Stary, C., Prilla, M., 2018. Designing Health Care That Works—Socio-technical Conclusions, in: Designing Healthcare That Works. Elsevier, pp. 187–203. 10.1016/B978-0-12-812583-0.00011-0.

IALA, 2022.- IALA WEBINAR ON INTRODUCTION TO IMO RESOLUTION A1158(32) GUIDELINES FOR VESSEL TRAFFIC SERVICES. [WWW Document], 2022. IALA AISM. https://www.youtube.com/watch?v=k79lgMTLtk8 (accessed 6.27.22).

IALA G1045.- Staffing Levels at VTS Centres. Edition 1.2 [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.org/product/staffing-levels-for-vts-personnel -1045/?download=true (accessed 6.7.22).

IALA G1045.- ED.1.1 ANNEX A- CALCULATION SPREADSHEET FOR STAFFING AT VTS CENTRES [WWW Document], 2018. IALA AISM. URL https://www.iala-aism.org/ product/g1045-ed-1-1-annex-calculation-spreadsheet-for-staffing-at-vts-centres/ (accessed 9.15.21).

IALA G1083.- STANDARD NOMENCLATURE TO IDENTIFY AND REFER TO A VTS. Edition 1.1 [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.or g/product/g1131-setting-measuring-vts-objectives/ (accessed 6.7.22).

IALA G1089.-PROVISION OF A VTS. Edition 2.0 [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.org/product/provision-of-vts-types-of-service-1089/?do wnload=true (accessed 6.7.22).

IALA G1111.- PREPARATION OF OPERATIONAL AND TECHNICAL PERFORMANCE REQUIREMENTS FOR VTS SYSTEMS [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.org/product/preparation-of-operational-and-technical-perfo rmance-for-vts-equipment/?download=true (accessed 6.7.22).

IALA G1131.- SETTING AND MEASURING VTS OBJECTIVES. Edition 1.1 [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.org/product/g1131-setti ng-measuring-vts-objectives/?download=true (accessed 6.7.22).

IALA G1141.- OPERATIONAL PROCEDURE FOR DELIVERING VTS. Edition 2.1 [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.org/product/oper ational-procedure-for-delivering-vts/?download=true (accessed 6.7.22).

IALA G1156.- RECRUITMENT, TRAINING AND CERTIFICATION OF VTS PERSONNEL. Edition 1.1 [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.org/ product/g1156-recruitment-training-and-certification-of-vts-personnel/?download =true (accessed 6.7.22).

IALA G1166.-VTS IN INLAND WATERS. Edition 1.0 [WWW Document], 2022. IALA AISM. URL https://www.iala-aism.org/product/g1166-ed1-0-vts-in-inland-waters/? download=true (accessed 6.8.22).

IALA Model Course V-103/1.- VESSEL TRAFFIC SERVICES OPERATOR TRAINING. Edition 2.0 [WWW Document], 2009. IALA AISM. URL https://www.iala-aism.org /product/vessel-traffic-service-operators-training-v-1031/?download=true (accessed 6.14.21).

IALA S1040.- VESSEL TRAFFIC SERVICES 1.0 [WWW Document], 2018. IALA AISM. URL https://www.iala-aism.org/product/s1040-vessel-traffic-services/?download =true (accessed 6.7.22).

IALA VTS Manual [WWW Document], 2021. IALA AISM. URL https://www.iala-aism. org/product/iala-vts-manual-2021/?download=true (accessed 6.14.21).

IMO A158 (ES.IV).- RECOMMENDATION ON PORT ADVISORY SERVICES [WWW Document], 1968. IMO. URL https://wwwcdn.imo.

org/localresources/en/OurWork/Safety/Documents/A.158(ES.IV).pdf (accessed 6.23.22).

IMO A578(14) - GUIDELINES FOR VESSEL TRAFFIC SERVICES [WWW Document], 1985. IMO. URL https://wwwcdn.imo.org/localresources/en/Knowledge Centre/IndexofIMOResolutions/AssemblyDocuments/A.578(14).pdf (accessed 6.7.22).

IMO A772(18) - FATIGUE FACTORS IN MANNING AND SAFETY [WWW Document], 1993. IMO. URL https://wwwcdn.imo.org/localresources/en/Knowledge Centre/IndexofIMOResolutions/AssemblyDocuments/A.772(18).pdf (accessed 6.7.22).

IMO A849(20) - CODE FOR THE INVESTIGATION OF MARINE CASUALTIES AND INCIDENTS [WWW Document], 1997. IMO. URL https://wwwcdn.imo.org/ localresources/en/KnowledgeCentre/IndexofIMOResolutions/AssemblyDocuments/ A.849(20).pdf (accessed 6.7.22).

IMO A857(20) - GUIDELINES FOR VESSEL TRAFFIC SERVICES [WWW Document], 1997. IMO. URL https://wwwcdn.imo.org/localresources/en/KnowledgeCentre/ IndexofIMOResolutions/AssemblyDocuments/A.857(20).pdf (accessed 6.7.22).

IMO A947(23) - Human Element vision, principles and goals for the organization [WWW Document], 2003. IMO. URL https://wwwcdn.imo.org/localresources/en/ KnowledgeCentre/IndexofIMOResolutions/AssemblyDocuments/A.947(23).pdf (accessed 6.23.22).

IMO A1110(30) - STRATEGIC PLAN FOR THE ORGANIZATION FOR THE SIX-YEAR PERIOD 2018 to 2023 [WWW Document], 2017. IMO. URL https://wwwcdn.imo. org/localresources/en/KnowledgeCentre/IndexofIMOResolutions/Assembly Documents/A.1110(30).pdf (accessed 6.23.22).

IMO A1158(32) - GUIDELINES FOR VESSEL TRAFFIC SERVICES [WWW Document], 2022. IMO. URL https://www.amsa.gov.au/file/9733/download?token=mBH80Uhi (accessed 6.23.22).

IMO MSC.202(81) - ADOPTION OF AMENDMENTS TO THE INTERNATIONAL CONVENTION FOR THE SAFETY OF LIFE AT SEA, 1974, AS AMENDED [WWW Document], 2006. IMO. URL https://wwwcdn.imo.org/localresources/en/ KnowledgeCentre/IndexofIMOResolutions/MSCResolutions/MSC.202(81).pdf (accessed 6.24.22).

IMO MSC.211(81) - ARRANGEMENTS FOR THE TIMELY ESTABLISHMENT OF THE LONG-RANGE IDENTIFICATION AND TRACKING SYSTEM [WWW Document], 2006. IMO. URL https://wwwcdn.imo.org/localresources/en/Knowledge Centre/IndexofIMOResolutions/MSCResolutions/MSC.211(81).pdf (accessed 6.24.22).

Jackson, S., 2010. Architecting Resilient Systems: Accident Avoidance, Survival, and Recovery from Disruptions, Architecting Resilient Systems: Accident Avoidance and Survival and Recovery from Disruptions. 10.1002/9780470544013.

Kohn, L.T., Corrigan, J., Donaldson, M.S. (Eds.), 2000. To err is human: building a safer health system. National Academy Press, Washington, D.C.

Kum, S., Furusho, M., 2014. Vessel Traffic Services (VTS) and VTS Personnel: Mental Workload of VTS Operator.

Lerman, S.E., Eskin, E., Flower, D.J., George, E.C., Gerson, B., Hartenbaum, N., Hursh, S. R., Moore-Ede, M., 2012. Fatigue risk management in the workplace. J. Occup. Environ. Med. 54, 231–258. https://doi.org/10.1097/JOM.0b013e318247a3b0.

Li, F., Chen, C.-H., Khoo, L.-P., Xu, G., 2018. Contextual information-based human fatigue prediction for integrated traffic control. In: Presented at the Proceedings of International Conference on Computers and Industrial Engineering, CIE.

Li, F., Chen, C.-H., Xu, G., Chang, D., Khoo, L.P., 2020a. Causal Factors and Symptoms of Task-Related Human Fatigue in Vessel Traffic Service: A Task-Driven Approach. J. Navig. 1–18 https://doi.org/10.1017/S0373463320000326.

Li, F., Chen, C.-H., Zheng, P., Feng, S., Xu, G., Khoo, L.P., 2020b. An explorative context- aware machine learning approach to reducing human fatigue risk of traffic control operators. Saf. Sci. 125, 104655 https://doi.org/10.1016/j.ssci.2020.104655.

Li, Jie, Goerlandt, Floris, Reniers, Genserik, 2021. An overview of scientometric mapping for the safety science community: Methods, tools, and framework. Saf. Sci. 134 https://doi.org/10.1016/j.ssci.2020.105093.

Luo, M., Shin, S.-H., 2019. Half-century research developments in maritime accidents: Future directions. Accid. Anal. Prev. 123, 448–460. https://doi.org/10.1016/j. aap.2016.04.010.

Lützhöft, M., Grech, M.R., Porathe, T., 2011. Information Environment, Fatigue, and Culture in the Maritime Domain. Rev. Hum. Factors Ergon. 7, 280–322. https://doi. org/10.1177/1557234X11410391.

MacLean, A.W., Davies, D.R.T., Thiele, K., 2003. The hazards and prevention of driving while sleepy. Sleep Med. Rev. 7, 507–521. https://doi.org/10.1016/S1087-0792(03) 90004-9.

MAIB, Marine Accident Investigation Branch, 2015. Collision between container vessel Ever Smart and oil tanker Alexandra 1 [WWW Document]. GOV.UK. URL https ://www.gov.uk/maib-reports/collision-between-container-vessel-ever-smart-and-oil -tanker-alexandra-1 (accessed 1.2.22).

Mansson, J.T., Lutzhoft, M., Brooks, B., 2017. Joint Activity in the Maritime Traffic System: Perceptions of Ship Masters, Maritime Pilots, Tug Masters, and Vessel Traffic Service Operators. J. Navig. 70, 547–560. https://doi.org/10.1017/ S0373463316000758.

Marcus, J., Rosekind, M., 2016. Fatigue in transportation: NTSB investigations and safety recommendations. Inj. Prev. J. Int. Soc. Child Adolesc. Inj. Prev. 23 https://doi.org/ 10.1136/injuryprev-2015-041791.

Ming-Cheng, Tsou, Sheng-Long, Kao, Chien-Min, Su, 2010. Decision Support from Genetic Algorithms for Ship Collision Avoidance Route Planning and Alerts. J. Navig. 63, 167–182.

Moore-Ede, M., Heitmann, A., Guttkuhn, R., Trutschel, U., Aguirre, A., Croke, D., 2004. Circadian alertness simulator for fatigue risk assessment in transportation:

F. Crestelo Moreno et al.

Safety Science 155 (2022) 105892

19

Application to reduce frequency and severity of truck accidents. Aviat. Space Environ. Med. 75, A107–A118.

Midwood, S.A., Glenn, I.N., Tummala, M., 1998. A multi sensor data fusion algorithm for the USCG’S vessel traffic services system, in: 1998 IEEE International Symposium on Circuits and Systems (ISCAS). Presented at the 1998 IEEE International Symposium on Circuits and Systems (ISCAS), pp. 545–548 vol.6. 10.1109/ISCAS.1998.705331.

MSC.1/Circ.1598 - GUIDELINES ON FATIGUE [WWW Document], 2019. IMO. URL htt ps://wwwcdn.imo.org/localresources/en/OurWork/HumanElement/Documents/ MSC.1-Circ.1598.pdf (accessed 6.7.22).

MSC/Circ.1014 - GUIDANCE ON FATIGUE MITIGATION AND MANAGEMENT [WWW Document], 2001. IMO. URL https://wwwcdn.imo.org/localresources/en/OurWor k/HumanElement/Documents/1014.pdf (accessed 6.7.22).

Mumford, E., 2006. The Story of Socio-Technical Design: Reflections on its Successes, Failures and Potential. Inf Syst J 16, 317–342. https://doi.org/10.1111/j.1365- 2575.2006.00221.x.

Murai, K., Kitamura, K., Hayashi, Y., 2015. Study of A Port Coordinator’s Mental Workload Based on Facial Temperature. Procedia Comput. Sci., Knowledge-Based and Intelligent Information & Engineering Systems 19th Annual Conference, KES- 2015, Singapore, September 2015 Proceedings 60, 1668–1675. 10.1016/j. procs.2015.08.277.

Napier, V., Findley, Carolyn Sara, Self, Donald Raymond, 2007. Risk Homeostasis: A case study of the adoption of a safety innovation on the level of perceived risk. In: AABSS. Presented at the 14th Annual Conference American Society of Business and Behavioral Sciences. Las Vegas, Nevada.

OECD, Organisation for Economic Co-operation and Development, 2021. Ocean shipping and shipbuilding. URL https://www.oecd.org/ocean/topics/ocean-shipping/ (accessed 12.26.21).

Page, M.J., McKenzie, J.E., Bossuyt, P.M., Boutron, I., Hoffmann, T.C., Mulrow, C.D., Shamseer, L., Tetzlaff, J.M., Akl, E.A., Brennan, S.E., Chou, R., Glanville, J., Grimshaw, J.M., Hróbjartsson, A., Lalu, M.M., Li, T., Loder, E.W., Mayo-Wilson, E., McDonald, S., McGuinness, L.A., Stewart, L.A., Thomas, J., Tricco, A.C., Welch, V.A., Whiting, P., Moher, D., 2021. The PRISMA 2020 statement: An updated guideline for reporting systematic reviews. PLOS Med. 18, e1003583 https://doi.org/10.1371/ journal.pmed.1003583.

Perrow, C., 2011. Normal Accidents: Living with High Risk Technologies - Updated Edition, Normal Accidents. Princeton University Press. 10.1515/9781400828494.

Phillips, R.O., Kecklund, G., Anund, A., Sallinen, M., 2017. Fatigue in transport: a review of exposure, risks, checks and controls. Transp. Rev. 37, 742–766.

PIANC, 2011. PIANC (Permanent International Association of Navigation Congresses). 2011. “Guidelines and Recommendations for River Information Services.” The Permanent Working Group 125 of the World Association for Waterborne Transport Infrastructure, Central commission for the navigation of the Rhine.

Praetorius, G., van Westrenen, F., Rushton, D., Hollnagel, E., 2012. Learning lessons in resilient traffic management: A cross-domain study of Vessel Traffic Service (VTS) and Air Traffic Control (ATC).

Praetorius, G., Hollnagel, E., Dahlman, J., 2015. Modelling Vessel Traffic Service to understand resilience in everyday operations. Reliab. Eng. Syst. Saf. 141, 10–21. https://doi.org/10.1016/j.ress.2015.03.020.

Randle, I., 2021. Introduction to human factors and the human element, in: Process Safety Management and Human Factors. Elsevier, pp. 9–23. 10.1016/B978-0-12- 818109-6.00002-2.

Relling, T., Lützhöft, M., Hildre, H.P., Ostnes, R., 2019. How vessel traffic service operators cope with complexity – only human performance absorbs human performance. Theor. Issues Ergon. Sci. 21, 418–441. https://doi.org/10.1080/ 1463922X.2019.1682711.

SOLAS - Chapter V, Rule 12 [WWW Document], 2002. IMO. URL https://assets.publish ing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/343 175/solas_v_on_safety_of_navigation.pdf (accessed 6.7.22).

Sulastri, S., 2020. The Effect of Work Stress and Workload on Employee Performance. 10.31219/osf.io/nvjqf.

UNCTAD, United Nations Conference on Trade and Development, 2021. Review of Maritime Transport 2021, in: REVIEW OF MARITIME TRANSPORT. p. 177.

VOSviewer - Visualizing scientific landscapes [WWW Document], n.d. VOSviewer. URL https://www.vosviewer.com// (accessed 1.29.22).

Walker, G., Stanton, N., Salmon, P., Jenkins, D., 2008. A Review of Sociotechnical Systems Theory: A Classic Concept for New Command and Control Paradigms. Theor. Issues Ergon. Sci. 9, 479–499. https://doi.org/10.1080/ 14639220701635470.

Xie, L., Chu, X., Huang, M., Yan, Z., 2011. Vessel Traffic Flow Detection and Tracking in River. 10.1061/41177(415)226.

Yen, J.-R., Wang, Y.-Y., Chang, C.-C., Chang, C.-Y., 2016. A structural equation analysis of vessel traffic controllers’ fatigue factors. Int. J. Shipp. Transp. Logist. 8, 442–455. https://doi.org/10.1504/IJSTL.2016.077309.

Yoo, S.-L., Kim, K.-I., 2021. Optimal Staffing for Vessel Traffic Service Operators: A Case Study of Yeosu VTS. Sensors 21, 8004. https://doi.org/10.3390/s21238004.

Zhao, G., He, Y., Yang, H., Tao, Y., 2021. Research on fatigue detection based on visual features. IET Image Process. https://doi.org/10.1049/ipr2.12207.

F. Crestelo Moreno et al.